DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and Casp6

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001258913.1 Gene:Casp6 / 83584 RGDID:70967 Length:277 Species:Rattus norvegicus


Alignment Length:266 Identity:103/266 - (38%)
Similarity:141/266 - (53%) Gaps:21/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ASEYNMSHKHRGVALIFNHE-FFDIPSLKSRTGTNVDAQELKKAFENLGFAVSVHKDCKLRDILK 131
            |.:|.|.||.||.||||||| ||...:|..|.|||.|...|.:.|..|||.|....|.:..::|.
  Rat    17 AEQYKMDHKRRGTALIFNHERFFWHLALPERRGTNADRDNLTRRFSELGFEVKCFNDLRAEELLL 81

  Fly   132 HVGKAAELDHTDNDCLAVAILSHGEHGYLYAKDTQYKLDNIWHYFTATFCPSLAGKPKLFFIQAC 196
            .:.:.:...|.|.||.....|||||..::||.|.:.::..:...|....|.||.||||:|.||||
  Rat    82 KIHEVSTSSHVDADCFLCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCQSLVGKPKIFIIQAC 146

  Fly   197 QGDRLDGGIT-----------LEKGVTETDGESSTSYKIPIHADFLFSYSTIPGYFSWRNINNGS 250
            :|.:.|..:.           |:..||:.|  :::.|.:|..||||..||...||:|.|...|||
  Rat   147 RGSQHDVPVVPLDVVDHQTDKLDDNVTQVD--AASVYTLPAGADFLMCYSVAEGYYSHRETVNGS 209

  Fly   251 WYMQSLIRELNANGKKYDLLTLLTFVNQRVA---LDFESNVPATPMMDRQKQIPCLTSMLTRILR 312
            ||:|.|...|..:|...:...|||.||::|:   :||..:    |....:||:||..||||:.|.
  Rat   210 WYIQDLCEMLARHGSSLEFTELLTLVNRKVSQRRVDFCKD----PGAIGKKQVPCFASMLTKKLH 270

  Fly   313 FGDKPN 318
            |..||:
  Rat   271 FCPKPS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 99/256 (39%)
Casp6NP_001258913.1 CASc 20..273 CDD:214521 100/258 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.