DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and CASP1

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001244047.1 Gene:CASP1 / 834 HGNCID:1499 Length:404 Species:Homo sapiens


Alignment Length:337 Identity:83/337 - (24%)
Similarity:135/337 - (40%) Gaps:49/337 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CVTRNYGVGIRSPNGSENRGSFI-MADNTDAKGCTPESLVV---------GGATAASPLPANKFV 59
            |...:|..|....:..:..|::: |.|:.......|....|         .|:.....|.:.:..
Human    77 CEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEA 141

  Fly    60 ARMPVERYASEY---NMSHKHRGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFAVSVH 121
            .|:..::.|..|   :.|.:.|...:|.|.||..||   .|||..||...:....:|||::|.|.
Human   142 QRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIP---RRTGAEVDITGMTMLLQNLGYSVDVK 203

  Fly   122 KDCKLRDILKHVGKAAEL-DHTDNDCLAVAILSHG-EHGYLYAKDTQ-----YKLDNIWHYFTAT 179
            |:....|:...:...|.. :|..:|...:..:||| ..|....|.::     .:|:.|::.....
Human   204 KNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTK 268

  Fly   180 FCPSLAGKPKLFFIQACQGDR-----------LDGGITLEKGVTETDGESSTSYKIPIHADFLFS 233
            .||||..|||:..||||:||.           :.|.::|.   |..:.|.....|..|..||:..
Human   269 NCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLP---TTEEFEDDAIKKAHIEKDFIAF 330

  Fly   234 YSTIPGYFSWRNINNGSWYMQSLIRELNANGKKYDLLTLLTFVNQRVALDFESNVPATPMMDRQK 298
            .|:.|...|||:...||.::..||..:.......|:..:.    ::|...||       ..|.:.
Human   331 CSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIF----RKVRFSFE-------QPDGRA 384

  Fly   299 QIPCLTSM-LTR 309
            |:|....: |||
Human   385 QMPTTERVTLTR 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 71/261 (27%)
CASP1NP_001244047.1 CARD_CASP1-like 5..87 CDD:260036 3/9 (33%)
CASc 153..402 CDD:214521 71/261 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.