DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and casp6b.1

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_005164109.1 Gene:casp6b.1 / 791531 ZFINID:ZDB-GENE-041010-48 Length:279 Species:Danio rerio


Alignment Length:249 Identity:99/249 - (39%)
Similarity:137/249 - (55%) Gaps:5/249 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 EYNMSHKHRGVALIFNHEFFDIP-SLKSRTGTNVDAQELKKAFENLGFAVSVHKDCKLRDILKHV 133
            ||:|.|..||:|||||.:.||.. .||:|.||:.|..:|...|:.|.|.|..:.|....|:|..:
Zfish    28 EYDMRHARRGMALIFNQKQFDWKLGLKTRNGTDKDRDDLVSRFQELNFEVKAYNDYSRDDVLLKI 92

  Fly   134 GKAAELDHTDNDCLAVAILSHGEHGYLYAKDTQYKLDNIWHYFTATFCPSLAGKPKLFFIQACQG 198
            .:|:..||.|.||.....|||||.|::||.|.:.::..|...|....|.||.||||:|..|||:|
Zfish    93 QEASAADHVDADCFVCIFLSHGEDGHVYANDKKIEIPEITDLFKGDKCRSLVGKPKIFIWQACRG 157

  Fly   199 DRLDGGITLEKGVTETD--GESSTSYKIPIHADFLFSYSTIPGYFSWRNINNGSWYMQSLIRELN 261
            |:||..:| |..|.:.:  .::...|.:|..|||:..|||..|:.|:|...|||||:|.|...|.
Zfish   158 DKLDDAVT-EMSVEDVEMAVDAGVLYTLPAGADFIMCYSTAEGFCSFREPLNGSWYIQDLCEILG 221

  Fly   262 ANGKKYDLLTLLTFVNQRVALDFESNVPATPMMDRQKQIPCLTSMLTRILRFGD 315
            ....:.....:||.||.:|:|....|......:.: ||:||..||||:.|.|.|
Zfish   222 RYHSELQFTDILTLVNMKVSLRSVPNCRNRAAIGK-KQMPCFASMLTKRLFFRD 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 96/244 (39%)
casp6b.1XP_005164109.1 CASc 29..272 CDD:237997 96/244 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.