DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and casp6b.2

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_017210076.1 Gene:casp6b.2 / 664751 ZFINID:ZDB-GENE-060312-12 Length:265 Species:Danio rerio


Alignment Length:251 Identity:96/251 - (38%)
Similarity:135/251 - (53%) Gaps:8/251 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 EYNMSHKHRGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFAVSVHKDCKLRDILKHVG 134
            ||:|.|..||:|||||.:.|.:..||:|.||:.|...|...||.|.|.|..:.|.....:||.:.
Zfish    18 EYDMKHAKRGLALIFNQKDFSLLGLKTRKGTDKDRDSLVSRFEELDFEVKAYNDYSRDKVLKEIK 82

  Fly   135 KAAELDHTDNDCLAVAILSHGEHGYLYAKDTQYKLDNIWHYFTATFCPSLAGKPKLFFIQACQGD 199
            :.|..||.|.||.....|||||.|::||.|.:.|:..|...|....|..|.||||:|..|||:||
Zfish    83 EVAAADHVDADCFVCIFLSHGEDGHVYANDEKIKIPEITDLFKGDKCRGLVGKPKIFIWQACRGD 147

  Fly   200 RLDGGI---TLEKGVTETDGESSTSYKIPIHADFLFSYSTIPGYFSWRNINNGSWYMQSLIRELN 261
            :.|..:   :.|....|...::..|..:|..|||:..|||..|:.|:|:..||:||:|.|...:.
Zfish   148 KKDDPVAPMSAEDSDDEMAVDAGVSNTLPAGADFIMCYSTTEGFCSFRDPLNGTWYIQDLCEIMG 212

  Fly   262 ANGKKYDLLTLLTFVNQRVAL-DFESNVPATPMMDRQKQIPCLTSMLTRILRFGDK 316
            ....:.:...:||.||::|:| ....::.||    ..||:||..||||:.|.|..|
Zfish   213 RYRSQLEFTNILTLVNRKVSLRSICDDLSAT----GTKQMPCFASMLTKRLFFRPK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 93/245 (38%)
casp6b.2XP_017210076.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.