DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and Casp2

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_038964243.1 Gene:Casp2 / 64314 RGDID:69274 Length:470 Species:Rattus norvegicus


Alignment Length:299 Identity:83/299 - (27%)
Similarity:121/299 - (40%) Gaps:59/299 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DNTD------AKGCTPESLVVGGATAASPLPANKFVARMPVERYASEYNMSHKHRGVALIF-NHE 87
            ||.|      .|.||||....                     .|...|.:..:.||:||:. |..
  Rat   166 DNGDGPPCLQVKPCTPEFYQA---------------------HYQLAYRLQSQPRGLALVMSNVH 209

  Fly    88 FFDIPSLKSRTGTNVDAQELKKAFENLGFAVSV--------HKDCKLRDILKHVGKAAELD---- 140
            |.....|:.|:|.:||...|...|:.||:.|.|        |:......|.|...|..|:.    
  Rat   210 FTGEKDLEFRSGGDVDHTTLVTLFKLLGYNVHVLYDQTAQFHRFQLYSGIYKKYPKGQEMQEKLQ 274

  Fly   141 -------HTDNDCLAVAILSHGEHGYLYAKDTQ-YKLDNIWHYFTATFCPSLAGKPKLFFIQACQ 197
                   |...|...||:||||..|.:|..|.: .:|..::..|....||||..|||:||||||:
  Rat   275 NFAQLPAHRVTDSCIVALLSHGVEGGIYGVDGKLLQLQEVFRLFDNANCPSLQNKPKMFFIQACR 339

  Fly   198 GDRLDGGITLE--------KGVTETDG--ESSTSYKIPIHADFLFSYSTIPGYFSWRNINNGSWY 252
            ||..|.|:..:        .|..|:|.  |.....::|..:|.:..|:.:.|..:.||...||||
  Rat   340 GDETDRGVDQQDGKNHAQSPGCEESDAGKEELMKMRLPTRSDMICGYACLKGNAAMRNTKRGSWY 404

  Fly   253 MQSLIRELNANGKKYDLLTLLTFVNQRVALDFESNVPAT 291
            :::|.:..:.......:..:|..||..:. :.|...|.|
  Rat   405 IEALTQVFSERACDMHVADMLVKVNALIK-EREGYAPGT 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 74/252 (29%)
Casp2XP_038964243.1 CARD_CASP2 32..118 CDD:260040
CASc 192..465 CDD:214521 74/252 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.