powered by:
Protein Alignment Dcp-1 and CARD18
DIOPT Version :9
Sequence 1: | NP_476974.1 |
Gene: | Dcp-1 / 37729 |
FlyBaseID: | FBgn0010501 |
Length: | 323 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_067546.1 |
Gene: | CARD18 / 59082 |
HGNCID: | 28861 |
Length: | 90 |
Species: | Homo sapiens |
Alignment Length: | 41 |
Identity: | 9/41 - (21%) |
Similarity: | 19/41 - (46%) |
Gaps: | 2/41 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MTDECVTRNYGVGIRSPNGSENRGSFIMADNTDAKGCTPES 41
:.||.:::.....:|..|.:....:.::.|....|| |:|
Human 30 LEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKG--PKS 68
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Dcp-1 | NP_476974.1 |
CASc |
71..313 |
CDD:214521 |
|
CARD18 | NP_067546.1 |
CARD_CASP1-like |
6..87 |
CDD:260036 |
9/41 (22%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3573 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.