DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and casp8

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_005165894.1 Gene:casp8 / 58022 ZFINID:ZDB-GENE-000713-1 Length:477 Species:Danio rerio


Alignment Length:276 Identity:86/276 - (31%)
Similarity:126/276 - (45%) Gaps:37/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 AASPLPANKFVARMPVERYASEYNMSHKHRGVALIF-NHEFFDIPSLKSRTGTNVDAQELKKAFE 112
            |.:||..|::            |.::.:..|..||. |:.|....:|..||||::|...|.|.|.
Zfish   221 AETPLNPNEY------------YILTQRPLGYCLIINNYNFLKSTNLLKRTGTDMDKDRLAKLFS 273

  Fly   113 NLGFAVSVHKDCKLRDILKHVGKAAELDHTDNDCLAVAILSHGEHGYLYAKDTQ-YKLDNIWHYF 176
            .:.|.:.|..|.:...|...:.:.|..:|.........||||||.|.:...|.: .::..:...|
Zfish   274 RMHFQIEVRSDLEAWAIKDEIKQFANKNHASMGAFVCCILSHGEKGTVLGTDGKPVEIREVTLPF 338

  Fly   177 TATFCPSLAGKPKLFFIQACQGDRLDGGITLEKGVTETDGESSTSY----------KIPIHADFL 231
            ..  |.:||.|||||||||||||....|:....| .|...|....|          ||||.||||
Zfish   339 AG--CRTLASKPKLFFIQACQGDENQAGVWTSDG-REDAPEEDEKYEEDAGIIVLRKIPIEADFL 400

  Fly   232 FSYSTIPGYFSWRNINNGSWYMQSLIREL-NANGKKYDLLTLLTFVNQRVALDFESNVPATPMMD 295
            ...:|:..|.|:|:...||.::|.|.::: ....||.|:|::||.||..|         :..::.
Zfish   401 IGMATVEHYLSYRHTKEGSIFIQELCKKMEELCPKKEDMLSILTKVNFEV---------SKRILK 456

  Fly   296 RQKQIPCLTSMLTRIL 311
            ..||:|.....||:.|
Zfish   457 GYKQMPEPRYTLTKKL 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 82/254 (32%)
casp8XP_005165894.1 DED_Caspase_8_10_r1 2..76 CDD:260059
DED_Caspase_8_10_r2 96..176 CDD:260042
CASc 230..475 CDD:237997 82/267 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.