DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and caspbl

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001139064.1 Gene:caspbl / 566185 ZFINID:ZDB-GENE-090311-53 Length:409 Species:Danio rerio


Alignment Length:322 Identity:73/322 - (22%)
Similarity:140/322 - (43%) Gaps:66/322 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PESLVVGGATAASPLPAN------------KFVARMPVERYASEYNMS---H------------- 75
            |:|:...|:....|:.::            :|..|:   .||:..:.|   |             
Zfish   104 PQSINTSGSDELEPIQSDWQRPRGIINRFQEFKTRL---LYANRDDASISIHFYKQNTLSIYTPV 165

  Fly    76 ---KHRGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFAVSVHKDCKLRDILKHVGK-A 136
               :.:|:||:..:..| ......|.|...|.:.::...:||.|.|..:::....:|.:.|.. :
Zfish   166 SRTQRKGLALLITNILF-ANKQDDRAGAERDEENMEWLLKNLNFMVIKYRNLTGNEISRAVQDFS 229

  Fly   137 AELDHTDNDCLAVAILSHGE------------HGYLYAKDTQYKLDNIWHYFTATFCPSLAGKPK 189
            ...:|.|.|...|.|:|||:            :.:|..::..|.:::.:.:..:..||:|..|||
Zfish   230 RRHEHQDADSTFVVIMSHGDRIQNKDAILGVNYNWLQNRNDVYFVEDTFSHLNSVNCPALIDKPK 294

  Fly   190 LFFIQACQGDRLDGGITLEKGVTETDGESSTSYKIPIHADFLFSYSTIPGYFSWRNINNGSWYMQ 254
            :..||||:|.:| ||:.::..|.|:|   |..:|   ..||:...||:|...::|:...||:::.
Zfish   295 VILIQACRGGQL-GGVPVKDCVPESD---SWVHK---EKDFVCFMSTMPDVVAYRDEVKGSYFIS 352

  Fly   255 SLIRELNANGKKYDLLTLLTFVNQRVALDFESNVPATPMMDRQ-KQIPCL--TSMLTRILRF 313
            .::....::..|..::.|...|..|:..|        ....|| |.:||:  ||::.:...|
Zfish   353 YIVDVFCSSACKDHIMELFRKVAARMEKD--------ERFRRQAKLLPCIERTSLVKKFYLF 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 64/276 (23%)
caspblNP_001139064.1 Pyrin_ASC-like 5..84 CDD:260033
CASc 167..406 CDD:237997 62/254 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.