DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and casp23

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001103182.1 Gene:casp23 / 563034 ZFINID:ZDB-GENE-071004-27 Length:446 Species:Danio rerio


Alignment Length:301 Identity:66/301 - (21%)
Similarity:116/301 - (38%) Gaps:69/301 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KGCTPESLVVG----GATAASPLPANKFVARMPVERYASE-------YNMSHKHRGVALIFNH-E 87
            ||.|..:...|    |.:...|.|.....:....|:..:|       .:.|.:.:.:||:.|: :
Zfish   166 KGVTNNAECCGNTGCGQSVTEPDPLKPCTSEFKAEKLMTEGKCIYPVKDKSPQRKRLALLINNVD 230

  Fly    88 FFDIPSLKSRTGTNVDAQELKKAFENLGFAVSVHKDCK-------LRDILKHVGKAAELDHTDND 145
            |.|    ..|||.:.|...:::..:.||::|...:|..       :||.      :...:|.|:|
Zfish   231 FKD----NVRTGADKDELSMERLLKGLGYSVVTLRDLSAQGMSTAMRDF------SQRKEHADSD 285

  Fly   146 CLAVAILSHGEHGYL------YAKDTQYKLDNIWHYFTATFCPSLAGKPKLFFIQACQGDRLDGG 204
            ...|.::|||:...:      .::|..:..|.|:.......|..|..|||:..||:|:|.:    
Zfish   286 SCFVVLMSHGDESGICGIFDSSSQDDVFPPDEIFKCLNTPNCAGLRDKPKIILIQSCRGGK---- 346

  Fly   205 ITLEKGVTETDGESSTSYKIPIHA--------DFLFSYSTIPGYFSWRNINNGSWYMQSLIRELN 261
                      .|.......:||..        ||....|:.|...|:||...||.::|.|:...|
Zfish   347 ----------PGNVDVPDSVPIRGTRREHKEKDFCCFRSSTPDTVSYRNKEKGSHFIQDLVEIFN 401

  Fly   262 ANGKKYDLLTLLTFVNQRVALDFESNVPATPMMDRQKQIPC 302
            .:..:.|:..|.    ::|.:.|...        ..:|:||
Zfish   402 RHAYEDDIEELF----RKVIMKFRET--------HDEQMPC 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 57/254 (22%)
casp23NP_001103182.1 CASc 210..444 CDD:320727 57/257 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.