DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and casp22

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001313475.1 Gene:casp22 / 561021 ZFINID:ZDB-GENE-060526-186 Length:376 Species:Danio rerio


Alignment Length:219 Identity:85/219 - (38%)
Similarity:120/219 - (54%) Gaps:10/219 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SEYNMSHKHRGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFAVSVHKDCKLRDILKHV 133
            :||.|....||:.||||:|.|..|.:| |.|:.:|...||..||.|||:|.:.:| :....:|..
Zfish   121 NEYEMKSNPRGLCLIFNNENFKDPDMK-RHGSQMDTASLKDLFEWLGFSVEIKQD-QTVSAMKRT 183

  Fly   134 GKAAELDHTDNDCLAVAILSHG-EHGYLYAKDTQYKLDNIWHYFTATFCPSLAGKPKLFFIQACQ 197
            .|....|....||....:|||| |.|.|.:.:....:|:|...|....|.|||||||:||||||:
Zfish   184 LKEYSEDRKHGDCFVCCVLSHGNESGVLGSDEKICPVDDITSPFNGANCSSLAGKPKVFFIQACR 248

  Fly   198 GDRLDGGITLEKGV----TETDGESSTSYKIPIHADFLFSYSTIPGYFSWRNINNGSWYMQSLIR 258
            |..:...:.:..|.    |:..|..|.|  ||..:|||.:.||:.||.|.|:..:|:|::|||..
Zfish   249 GHEIQSKVMVADGSGGSRTQKPGRVSVS--IPKDSDFLIARSTVEGYVSIRDRTSGTWFIQSLCE 311

  Fly   259 ELNANGKK-YDLLTLLTFVNQRVA 281
            .|....|: :|:|.:||.||..|:
Zfish   312 NLKEGSKRGHDILMILTKVNNDVS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 84/217 (39%)
casp22NP_001313475.1 CARD 3..88 CDD:279013
CASc 123..366 CDD:237997 84/217 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.