DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and casp7

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001018443.1 Gene:casp7 / 553634 ZFINID:ZDB-GENE-050522-506 Length:316 Species:Danio rerio


Alignment Length:249 Identity:108/249 - (43%)
Similarity:153/249 - (61%) Gaps:8/249 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 EYNMSHKHRGVALIFNHEFFDIPS-LKSRTGTNVDAQELKKAFENLGFAVSVHKDCKLRDILKHV 133
            :|.|||:..|..:|.|::.||..: :..|.||:.||.||.|.|::|||.|:|:.|...|::.:.:
Zfish    70 QYKMSHQRVGKCIIINNKNFDEKTGMNVRNGTDRDAGELFKCFKSLGFDVAVYNDQTCRNMERLL 134

  Fly   134 GKAAELDHTDNDCLAVAILSHGEHGYLYAKDTQYKLDNIWHYFTATFCPSLAGKPKLFFIQACQG 198
            ...:|.||:|:.|.|..:|||||.|.:|..|....:..:...|....|.||.|||||||||||:|
Zfish   135 KAVSEEDHSDSSCFACILLSHGEEGMIYGTDGAMPIKTMTSLFKGDVCKSLVGKPKLFFIQACRG 199

  Fly   199 DRLDGGITLEKG----VTETDGESSTSYKIPIHADFLFSYSTIPGYFSWRNINNGSWYMQSLIRE 259
            ...|.|:..:.|    ..|||  ::..:|||:.|||||:|||:|||:||||...|||::|:|...
Zfish   200 SEFDDGVQTDSGPPNDTIETD--ANPRHKIPVEADFLFAYSTVPGYYSWRNPGRGSWFVQALCNV 262

  Fly   260 LNANGKKYDLLTLLTFVNQRVALDFESNVPATPMMDRQKQIPCLTSMLTRILRF 313
            |:..||:.:::.:||.||..||..||| ....|....:|||||:.||||:.|.|
Zfish   263 LSEFGKQLEIMQILTRVNYMVATSFES-WSEDPRFSEKKQIPCVVSMLTKELYF 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 107/246 (43%)
casp7NP_001018443.1 CASc 71..315 CDD:237997 107/246 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580505
Domainoid 1 1.000 200 1.000 Domainoid score I2984
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11168
Inparanoid 1 1.050 209 1.000 Inparanoid score I3655
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 1 1.000 - - mtm6547
orthoMCL 1 0.900 - - OOG6_103710
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X460
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.700

Return to query results.
Submit another query.