DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and casp6a

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001018333.1 Gene:casp6a / 552927 ZFINID:ZDB-GENE-030825-4 Length:298 Species:Danio rerio


Alignment Length:305 Identity:116/305 - (38%)
Similarity:158/305 - (51%) Gaps:24/305 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 MADNT--DAKGCTPESLVVGGATAASPLPA----NKFVARMPVERYASEYNMSHKHRGVALIFNH 86
            ||.:|  |......:.....|.|....|..    |:.:..|...:   ||:|:||.||:||||||
Zfish     1 MASHTKSDGSAAVEKDSASAGQTVEENLTETDSFNQSIFSMDPNQ---EYDMNHKRRGMALIFNH 62

  Fly    87 E-FFDIPSLKSRTGTNVDAQELKKAFENLGFAVSVHKDCKLRDILKHVGKAAELDHTDNDCLAVA 150
            | ||....|..|:|||.|.:.|.:.|..|.|.|....|.|..::|..:.:||..||.|.|||...
Zfish    63 ENFFWKLGLGYRSGTNADKENLIRRFRELNFEVKAFDDYKRHEVLSKITEAAAADHVDADCLVCV 127

  Fly   151 ILSHGEHGYLYAKDTQYKLDNIWHYFTATFCPSLAGKPKLFFIQACQGDRLDGGIT----LEKGV 211
            .|||||:|::||.|.|.::..|...|....|.||.||||:|..|||:||:.|..:|    ::..|
Zfish   128 FLSHGENGHVYANDGQIEIPEITDLFKGDKCRSLVGKPKIFIWQACRGDKHDDPVTPMDVVDSQV 192

  Fly   212 T-ETDGESSTSYKIPIHADFLFSYSTIPGYFSWRNINNGSWYMQSLIRELNANGKKYDLLTLLTF 275
            | :...::...|.:|..|||:..||...||:|.|...|||||:|.|...|...|.:.:...:||.
Zfish   193 TNDMVVDAGVLYTLPAGADFIMCYSVAEGYYSHRETVNGSWYIQDLCEILRRYGSELEFAEILTL 257

  Fly   276 VNQRVALDFESNVPATPMMDR----QKQIPCLTSMLTRILRFGDK 316
            ||::|:|....|     ..||    :||:||..||||:.|.|..|
Zfish   258 VNRKVSLRSVLN-----CKDRSAVGKKQVPCFASMLTKKLFFRPK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 104/251 (41%)
casp6aNP_001018333.1 CASc 47..294 CDD:237997 104/251 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.