DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and casp6

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001011068.1 Gene:casp6 / 496478 XenbaseID:XB-GENE-482797 Length:304 Species:Xenopus tropicalis


Alignment Length:265 Identity:101/265 - (38%)
Similarity:149/265 - (56%) Gaps:20/265 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ASEYNMSHKHRGVALIFNHE-FFDIPSLKSRTGTNVDAQELKKAFENLGFAVSVHKDCKLRDILK 131
            ::||.|:||.||:||||||| |:....|.||.|||.|:..|.:...:|||.|..:.:.:..|||:
 Frog    48 SAEYKMTHKRRGLALIFNHEDFYWQLRLGSRRGTNTDSMNLNRILTDLGFDVQNYYNLRTLDILE 112

  Fly   132 HVGKAAELDHTDNDCLAVAILSHGEHGYLYAKDTQYKLDNIWHYFTATFCPSLAGKPKLFFIQAC 196
            .:.:|:..||::.||.....|||||..::|:.|:...:..:.:.|....|.||.||||:|..|||
 Frog   113 KIQEASTADHSNADCFLCVFLSHGEDRHIYSYDSLIDIQELTNSFKGDKCESLVGKPKIFIFQAC 177

  Fly   197 QGDRLDG---------GITLEKGVTETDGESSTSYKIPIHADFLFSYSTIPGYFSWRNINNGSWY 252
            :|::.|.         .:|| ..:||.|  :::.|.:|..|||:..||...||:|.|...|||||
 Frog   178 RGEKHDNPVLPTDETDSVTL-TNITEVD--AASLYTLPAGADFIMCYSVAEGYYSHRETVNGSWY 239

  Fly   253 MQSLIRELNANGKKYDLLTLLTFVNQRVALDFESNVP--ATPMMDRQKQIPCLTSMLTRILRFGD 315
            :|.|...|.|:....:...:||.||::|:   :.:|.  ..|....:|||||.:||||:.|..  
 Frog   240 IQDLCEVLKAHAASLEFTEILTLVNRKVS---QRSVAFCNDPKAIGKKQIPCFSSMLTKKLFL-- 299

  Fly   316 KPNGN 320
            ||..|
 Frog   300 KPKSN 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 97/253 (38%)
casp6NP_001011068.1 CASc 51..300 CDD:237997 97/256 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 1 1.000 - - mtm14079
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3066
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.