DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and Decay

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster


Alignment Length:291 Identity:101/291 - (34%)
Similarity:154/291 - (52%) Gaps:26/291 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ATAASPLPANKF-VARMPVERYASEYNMSHKHR-GVALIFNHEFFDIPSLKSRTGTNVDAQELKK 109
            ||..:..|.::. :.|:.:.|..:|....:..| |:|||.||:  |:...|.|.||..|..:::.
  Fly    22 ATKIAHTPTSELDLKRIIISRPTNEDTYENCARAGIALILNHK--DVKGQKQRVGTERDRDDMEA 84

  Fly   110 AFENLGFAVSVHKD---CKLRDILKHVGKAAELDHTDNDCLAVAILSHGEHGYLYAKDTQYKLDN 171
            ..:..||.|....|   .::.|.||.|   |..||:.|||..:|::|||..|.:||||..|.::.
  Fly    85 TLQGFGFDVRTFDDLTFSEINDTLKEV---AREDHSQNDCFVLAVMSHGTEGKVYAKDMSYPVER 146

  Fly   172 IWHYFTATFCPSLAGKPKLFFIQACQGDRLDGGI--------TLEKGVTETDGESSTSYKIPIHA 228
            :|:.|....|.:|..||||||||||:|..|:..:        |.|............:|.||..|
  Fly   147 LWNPFLGDNCKTLKNKPKLFFIQACRGANLEKAVEFSSFAVMTRELVPEPAAAVQPITYAIPSTA 211

  Fly   229 DFLFSYSTIPGYFSWRNINNGSWYMQSLIRELN-------ANGKKYDLLTLLTFVNQRVALDFES 286
            |.|..|||...:||:||:::|||::|||.|.|:       |..:..:||.|||.||::||.:::|
  Fly   212 DILVFYSTFDKFFSFRNVDDGSWFIQSLCRVLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQS 276

  Fly   287 NVPATPMMDRQKQIPCLTSMLTRILRFGDKP 317
            |. ....:::.|::|...|.||:..:...||
  Fly   277 NT-KNEALNQMKEMPNFMSTLTKTFQLRVKP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 93/260 (36%)
DecayNP_477462.1 CASc 54..302 CDD:237997 93/253 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457287
Domainoid 1 1.000 130 1.000 Domainoid score I3239
eggNOG 1 0.900 - - E1_KOG3573
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I3180
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 1 1.000 - - mtm4766
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.