DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and Dronc

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster


Alignment Length:236 Identity:62/236 - (26%)
Similarity:106/236 - (44%) Gaps:31/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 YNM-SHKHRGVALIFNHEFFDIPSL-KSRTGTNVDAQELKKAFENLGFAV----SVHKDCKLRDI 129
            |.| |..:|||.|:.|  ..|.|.. :.|.|...|::.|...|:.|.|.:    :|::| :...:
  Fly   187 YKMQSRFNRGVLLMVN--IMDYPDQNRRRIGAEKDSKSLIHLFQELNFTIFPYGNVNQD-QFFKL 248

  Fly   130 LKHVGKAAELDHTDNDCLAVAILSH-----GEHGYLYAKDTQYKLDNIWHYFTATFCPSLAGKPK 189
            |..|..::.:.:|  :|..:.:::|     |:....:...:...:..|..:|....||.|..|||
  Fly   249 LTMVTSSSYVQNT--ECFVMVLMTHGNSVEGKEKVEFCDGSVVDMQKIKDHFQTAKCPYLVNKPK 311

  Fly   190 LFFIQACQGDRLDGGITLEKG---------------VTETDGESSTSYKIPIHADFLFSYSTIPG 239
            :.....|:||..|.|....:|               .|:|:|..|.|..:|..||.|..|:..||
  Fly   312 VLMFPFCRGDEYDLGHPKNQGNLMEPVYTAQEEKWPDTQTEGIPSPSTNVPSLADTLVCYANTPG 376

  Fly   240 YFSWRNINNGSWYMQSLIRELNANGKKYDLLTLLTFVNQRV 280
            |.:.|:::.||||:|...:.:..:....||..:|...::.|
  Fly   377 YVTHRDLDTGSWYIQKFCQVMADHAHDTDLEDILKKTSEAV 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 62/236 (26%)
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 62/236 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457286
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.