DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and cflara

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001300701.1 Gene:cflara / 373114 ZFINID:ZDB-GENE-030826-3 Length:461 Species:Danio rerio


Alignment Length:270 Identity:61/270 - (22%)
Similarity:98/270 - (36%) Gaps:79/270 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 NKFVARMP------VERYASEYNMSHKHRGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENL 114
            ||....:|      .:....||.|:.:.||:.:|.:             ....|.:.||..||.|
Zfish   220 NKLKLSVPETGIHYQQAITEEYQMNPEQRGLCVIID-------------CVGYDGEMLKHTFECL 271

  Fly   115 GFAVSVH------------KDCKLRDILKHVGKAAELDHTDNDCLAVAILSHGEHGYLYAKDTQ- 166
            ||.|..|            :|..|..||:.|           .|....::|.|.:.:|.|.|:. 
Zfish   272 GFKVVFHSLLGLKETQKVLEDLSLNRILQRV-----------RCFVCCLISRGTNTHLLATDSNR 325

  Fly   167 --YKLDNIWHYFTATFCPSLAGKPKLFFIQACQGDRLDGGITLEKGVTETDG----ESSTSYKIP 225
              ..|.::...|.||.|      ||:||.|..:........:::....|||.    :.|.:..:|
Zfish   326 LGINLKDLKQLFNATKC------PKIFFTQLYRITEAPVMPSMDDEYLETDAPASRQCSNTGSVP 384

  Fly   226 IHADFLFSYSTIPGYFSWRNINNGSWYMQSLIRELNANGKKYDLLTLLTFVNQRVALDFESNVPA 290
            :.||.|:|..|                  :.::.|..:|.:...|..|   |..:....|.||  
Zfish   385 MPADVLWSVCT------------------AEVKLLEESGHQSVYLNAL---NNALLKGHERNV-- 426

  Fly   291 TPMMDRQKQI 300
             |::|..|::
Zfish   427 -PILDVMKEV 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 57/249 (23%)
cflaraNP_001300701.1 DED 8..87 CDD:307481
DED_c-FLIP_r2 100..180 CDD:260046
CASc 241..461 CDD:320727 57/249 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.