powered by:
Protein Alignment Dcp-1 and Pea15
DIOPT Version :9
Sequence 1: | NP_476974.1 |
Gene: | Dcp-1 / 37729 |
FlyBaseID: | FBgn0010501 |
Length: | 323 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001013249.1 |
Gene: | Pea15 / 364052 |
RGDID: | 1306055 |
Length: | 130 |
Species: | Rattus norvegicus |
Alignment Length: | 69 |
Identity: | 19/69 - (27%) |
Similarity: | 27/69 - (39%) |
Gaps: | 17/69 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 DIPSLKSRTGTNVDA--------QELKKAFENLGFAVSVHKDCKLRDIL-------KHVGKAAEL 139
||||.||...|...| .:|.| :||.:...:.:..:..|:| ..|.|.:|.
Rat 30 DIPSEKSEEITTGSAWFSFLESHNKLDK--DNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEE 92
Fly 140 DHTD 143
|..|
Rat 93 DELD 96
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3573 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.