DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and Dredd

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster


Alignment Length:288 Identity:77/288 - (26%)
Similarity:126/288 - (43%) Gaps:60/288 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SPLPANKFVARMPVERYASEYN-------------MSHKHRGVALIFNHE------------FFD 90
            :|.|.....|.|.|::.....|             ::.::.|:|||.|.:            |..
  Fly   218 APEPDAAGTAAMAVKQEIESDNQQSYCSTQIDALKLTRENAGIALIINQQKFHRNVSRDNMKFLS 282

  Fly    91 IPSLKSRTGTNVDAQELKKAFENLGFAVSVHKDCKLRDILKHVGKAAELDHTDNDCLAVAILSHG 155
            ...|:.|.||:||.:.|.:.|.::|:.|..:.:.....|::.:..|.:.... .|.|.|.|||||
  Fly   283 PDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGIIERIRSACDRSLV-RDSLVVFILSHG 346

  Fly   156 EHGYLYAKDT-QYKL----DNIWHYFTATFCPSLAGKPKLFFIQACQGDRLDGGITLEKGVTETD 215
            ....:||.:: ..|:    |.:..|.|..:      ||||..|||||          ||.|.:. 
  Fly   347 FEEAVYASNSIAMKITDIEDLLCSYDTLYY------KPKLLIIQACQ----------EKLVHKK- 394

  Fly   216 GESSTSYKIPI-------HADFLFSYSTIPGYFSWRNINNGSWYMQSL---IRELNANGKKYDLL 270
             :.:..::|.:       |.|.|.:.||:.||.:.|:...|||::.||   |...:|:....|:|
  Fly   395 -KPNELFRIDVTTVSPDQHIDMLRAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRSASEHIADIL 458

  Fly   271 TLLT-FVNQRVALDFESNVPATPMMDRQ 297
            |::| .|:::...:.||.||......||
  Fly   459 TIVTNEVSKKRGSNDESMVPNVKSTFRQ 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 72/268 (27%)
DreddNP_477249.3 CASc 252..492 CDD:294037 71/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457289
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.