DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and Casp14

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001178705.1 Gene:Casp14 / 299587 RGDID:1311781 Length:246 Species:Rattus norvegicus


Alignment Length:218 Identity:60/218 - (27%)
Similarity:102/218 - (46%) Gaps:33/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 YNMSHKHRGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFAVSVHKDCKLRDILKHVGK 135
            |:||.....:.|...         |:|.|:.||...|::.|:.|.|..::.:|...:..|..:. 
  Rat    16 YDMSGARLALTLCVT---------KAREGSEVDMDALERMFQYLKFESTMKRDPTAQQFLDDMD- 70

  Fly   136 AAELDHT-DN-----DCLAVAILSHGEHGYLYAKD-TQYKLDNIWHYFTATFCPSLAGKPKLFFI 193
              |...| :|     .|..|.:::|||.|:|..:| ...:|::::.......|.:|.||||::.|
  Rat    71 --EFQQTIENWKEPVSCAFVVLMAHGEEGFLKGEDGNMVRLEDLFEVLNNKNCKALRGKPKVYII 133

  Fly   194 QACQGDRLDGGITLEKGVTETDGESSTSYK------IPIHADFLFSYSTIPGYFSWRNINNGSWY 252
            |||:|:..|.|       .|..|:.....|      ||.:.|.:..|||:.|:.|:|:...||.:
  Rat   134 QACRGEHRDPG-------EELPGDELAVIKKKNPPTIPTYTDMIHIYSTVEGFLSYRHDQKGSGF 191

  Fly   253 MQSLIRE-LNANGKKYDLLTLLT 274
            :|:|... ::..|...:||..:|
  Rat   192 IQTLTDVFIHKKGSITELLEEIT 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 60/218 (28%)
Casp14NP_001178705.1 CASc 10..246 CDD:237997 60/218 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.