DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and csp-3

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_493011.2 Gene:csp-3 / 190006 WormBaseID:WBGene00000821 Length:139 Species:Caenorhabditis elegans


Alignment Length:138 Identity:43/138 - (31%)
Similarity:58/138 - (42%) Gaps:31/138 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 FFIQ---ACQG------DRLDGGITLEKGVTETDGESSTSYKIPIH------ADFLFSYSTIPGY 240
            ||:|   .|.|      ||:.......|.            |.|.|      ||.|.|:||.||:
 Worm    11 FFLQRAVRCDGFIDNFFDRIPKFFQFMKS------------KFPSHQTSSSQADLLVSFSTSPGF 63

  Fly   241 FSWRNINNGSWYMQSLIRELNANGKKYDLLTLLTFVNQRVALDFESNVPATPMMDRQKQIPCLTS 305
            .|:::....:||:|.|.|.:..|.|...|..|||..|:||...:|    |..::...||.|...|
 Worm    64 LSFKDETKDTWYIQELYRVIIENAKDTHLADLLTETNRRVVEKYE----ADKVVFVCKQAPEFWS 124

  Fly   306 MLTRILRF 313
            ..|:.|.|
 Worm   125 RFTKQLFF 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 42/136 (31%)
csp-3NP_493011.2 CASc <11..132 CDD:320727 42/136 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162600
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.