DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and ZK795.2

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_502403.2 Gene:ZK795.2 / 178206 WormBaseID:WBGene00014082 Length:292 Species:Caenorhabditis elegans


Alignment Length:84 Identity:18/84 - (21%)
Similarity:33/84 - (39%) Gaps:19/84 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 LYAKDTQYKLDNIWHYFTATFCPSLAG----KPKLFFIQACQ-------------GDRLDGGITL 207
            ||....|.|...|:.:...:.|..:.|    |.:..||...:             |.:..|.:.:
 Worm    51 LYIAKHQVKSPQIFVHENGSICEFIGGVDRSKMRADFILVIKKHTSQKLKCDPEWGRQSFGVLNI 115

  Fly   208 EK--GVTETDGESSTSYKI 224
            ||  .:::||.:.:.:.||
 Worm   116 EKYPTLSQTDEDLAFTAKI 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 18/84 (21%)
ZK795.2NP_502403.2 DUF1510 180..>263 CDD:284770
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.