DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and csp-1

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001022452.1 Gene:csp-1 / 175007 WormBaseID:WBGene00000819 Length:536 Species:Caenorhabditis elegans


Alignment Length:341 Identity:84/341 - (24%)
Similarity:151/341 - (44%) Gaps:51/341 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TRNYGVGIRSPNGSENRGSFIMADNTDAKGCTPESLVVGGATAASPLPANKFVARMPVERYASEY 71
            |.|....|:.|:..|      ..|...:.|.:.:..::...|........:......:|.|.|:.
 Worm   209 TENKDPNIQEPSPVE------FLDVQSSLGSSMKPPILDKPTKLDDPAETRHDCSYSLEEYDSQS 267

  Fly    72 NM--------SHKH----------RGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFAV 118
            .|        :|||          ||..||.::|.|  .:::.|.||..|...|.|.|:.|.:.|
 Worm   268 RMPRTDAKKSNHKHKYCYEMNSNPRGTVLILSNENF--KNMERRVGTKQDEVNLTKLFQKLQYTV 330

  Fly   119 SVHKDCKLRDILKHVGKAAELDHTDNDCLAVAILSHGE-HGYLYAKDTQYKLDNIWHYFT-ATFC 181
            ...::.:...:|:.:.:.||:.|||:  :.:.:||||: .|.::..|....  |:....| ..:.
 Worm   331 ICKRNLEAESMLEAIKEFAEMAHTDS--IILFLLSHGDGAGSVFGIDDMPV--NVMEVSTYLAYH 391

  Fly   182 PSLAGKPKLFFIQACQGDRLDGGITLEKGVTETDGESSTSYKI--------------PIHADFLF 232
            .:|..|||...:.||:|.:|:.|:.:: |:...:.:.:...|.              .::||.:.
 Worm   392 QNLLLKPKWVAVSACRGGKLNMGVPVD-GLPALEDKCAPISKFWNLMMSRIMPGTFTSLNADVII 455

  Fly   233 SYSTIPGYFSWRNINNGSWYMQSLIRELNANGKKYDLLTLLTFVNQRVALDFESNVPATPMMDRQ 297
            |:||..|:.|:|:...|:||::|:.:..|.:.|...||.:||...:.|...:| ||....::   
 Worm   456 SFSTTDGFTSYRDEEAGTWYIKSMCKVFNKHSKTMHLLDILTETGRNVVTKYE-NVQGNVVL--- 516

  Fly   298 KQIPCLTSMLTRILRF 313
            ||.|.:.|.||:...|
 Worm   517 KQAPEILSRLTKQWHF 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 72/275 (26%)
csp-1NP_001022452.1 SPK 76..188 CDD:214732
CASc 285..533 CDD:214521 69/259 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I3239
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 1 1.000 - - mtm4766
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.