DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and Casp12

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_569106.1 Gene:Casp12 / 156117 RGDID:621758 Length:420 Species:Rattus norvegicus


Alignment Length:262 Identity:73/262 - (27%)
Similarity:115/262 - (43%) Gaps:39/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 MPVERYASEYNMSHK--HRGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFAVSVHKDC 124
            |..||....|.:..|  ...:|||..::.||.  |..|.....|...:|:..:|||::|.:.::.
  Rat   158 MKTERAEEIYPVMEKEGRTRLALIICNKKFDY--LFDRDDAETDILNMKELLQNLGYSVVIKENL 220

  Fly   125 KLR----DILKHVGKAAELDHTDNDCLAVAILSHG-EHGYLYAKDTQYKL-----DNIWHYFTAT 179
            ..:    :::|..|:.   :|..:|...:..:||| ..|....|....|.     |.|:..|..:
  Rat   221 TAQEMETELMKFAGRP---EHQSSDSTFLVFMSHGILEGICGVKHRNKKPDVLHDDTIFTIFNNS 282

  Fly   180 FCPSLAGKPKLFFIQACQGDRLDGGI--TLEKGV--TETDGESSTSY-------KIPIHADFLFS 233
            .||||..|||:..:|||:| |..|.|  :..||:  .:||.|...|:       |..:..||:..
  Rat   283 NCPSLRNKPKILIMQACRG-RHTGTIWVSTSKGIATADTDEECVLSHRWNNSITKAHVETDFIAF 346

  Fly   234 YSTIPGYFSWRNINNGSWYMQSLIRELNANGKKYDLLTLLTFVNQRVALDFESNVPA----TPMM 294
            .|:.|...||:...:||.::..||...    |||.....|..:.::|...||  ||.    .|.:
  Rat   347 KSSTPHNISWKVGKSGSLFISKLIDCF----KKYCWCYHLEEIFRKVQYSFE--VPGELTQMPTI 405

  Fly   295 DR 296
            :|
  Rat   406 ER 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 70/253 (28%)
Casp12NP_569106.1 CARD_CASP1-like 6..88 CDD:260036
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..115
CASc 167..418 CDD:214521 70/253 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.