DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and Casp1

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_033937.2 Gene:Casp1 / 12362 MGIID:96544 Length:402 Species:Mus musculus


Alignment Length:313 Identity:86/313 - (27%)
Similarity:138/313 - (44%) Gaps:45/313 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DECVTRNYGVGIRSPNGSENRGSFIMADNTDAKGCTPESLV--------------VGGATAASPL 53
            ::|    |..||.....:.:..:|:..:  |:||..|.|..              :.|.....||
Mouse    79 EDC----YLAGILELQSAPSAETFVATE--DSKGGHPSSSETKEEQNKEDGTFPGLTGTLKFCPL 137

  Fly    54 -PANKFVARMPVERYASEYNMSHKHRGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFA 117
             .|.|.....|.|.|.. .|.:.:.|...:|.|.||   ..|..|.|..||.:|:|...|:||:.
Mouse   138 EKAQKLWKENPSEIYPI-MNTTTRTRLALIICNTEF---QHLSPRVGAQVDLREMKLLLEDLGYT 198

  Fly   118 VSVHKDCKLRDILKHVGK-AAELDHTDNDCLAVAILSHGEH----GYLYAKDTQ--YKLDNIWHY 175
            |.|.::....:::|.|.: ||..:|..:|...:..:|||..    |..|:.:..  .|:|.|:..
Mouse   199 VKVKENLTALEMVKEVKEFAACPEHKTSDSTFLVFMSHGIQEGICGTTYSNEVSDILKVDTIFQM 263

  Fly   176 FTATFCPSLAGKPKLFFIQACQGDRLDGGITLEKGVTETDGESSTS--------YKIPIHADFLF 232
            .....||||..|||:..||||:|:: .|.:.|:..|.:::.:..|.        .|..|..||:.
Mouse   264 MNTLKCPSLKDKPKVIIIQACRGEK-QGVVLLKDSVRDSEEDFLTDAIFEDDGIKKAHIEKDFIA 327

  Fly   233 SYSTIPGYFSWRNINNGSWYMQSLIRELNANGKKYDLLTLLTFVNQRVALDFE 285
            ..|:.|...|||:...||.:::|||:.:    |:|.....|..:.::|...||
Mouse   328 FCSSTPDNVSWRHPVRGSLFIESLIKHM----KEYAWSCDLEDIFRKVRFSFE 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 68/230 (30%)
Casp1NP_033937.2 CARD_CASP1-like 6..87 CDD:260036 3/11 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..125 6/28 (21%)
CASc 152..400 CDD:214521 69/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.