DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and Cflar

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001029036.1 Gene:Cflar / 117279 RGDID:620847 Length:480 Species:Rattus norvegicus


Alignment Length:243 Identity:63/243 - (25%)
Similarity:99/243 - (40%) Gaps:37/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 MPVERYASEYNMSHKHRGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFAVSVHKDCKL 126
            :|...:...|.|..|..|:.||.:             ....|.:.|::.|.:||:.|........
  Rat   240 LPPHIHEESYRMQSKPLGICLIID-------------CIGNDTEYLRETFTSLGYRVQPFLFPSS 291

  Fly   127 RDILKHVGKAAEL-DHTDNDCLAVAILSHGEHGYLYAKDTQY---KLDNIWHYFTATFCPSLAGK 187
            .:|.:.|.:.:.: .|.|.|.....::|.|....:...|..|   .|:|:...|....||||.||
  Rat   292 HEITQIVRRFSNMTQHQDYDSFVCVLVSRGGSQSMMGVDQVYSGFSLENVKDMFKGDMCPSLRGK 356

  Fly   188 PKLFFIQACQGDRLDGGITLEKGVTETDGES----STSYKIPIH------ADFLFSYSTIPGYFS 242
            |||||||..:        .||....|.||.:    ::.:..|.|      ||..:|..|......
  Rat   357 PKLFFIQNYE--------ALEDNSLEVDGPAIKNVNSRHLHPRHCTTHPDADIFWSLCTADVSRL 413

  Fly   243 WRNINNGSWYMQSLIRELNANGKKYDLLTLLTFVNQRVALDFESNVPA 290
            .:..::.|.|:|.| .:|...|:|..|:.|...:..:| ..:.||||:
  Rat   414 EQPSSSLSVYLQKL-SQLLEQGRKRSLVDLHVELMDKV-YAWNSNVPS 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 62/234 (26%)
CflarNP_001029036.1 DED_c-FLIP_r1 6..85 CDD:260044
DED_c-FLIP_r2 96..176 CDD:260046
CASc 249..479 CDD:412128 62/234 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.