DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and Casp4

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_446188.2 Gene:Casp4 / 114555 RGDID:621757 Length:373 Species:Rattus norvegicus


Alignment Length:262 Identity:71/262 - (27%)
Similarity:110/262 - (41%) Gaps:58/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 RGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFAVSVHK-------DCKLRDILKHVGK 135
            |...:|.|.||   ..|..|.|.|:|...:|...|.||:.|.|.:       :.:::|.      
  Rat   132 RKALIICNTEF---KHLSLRYGANIDISGMKGLLEELGYDVVVKEELTAEGMESEMKDF------ 187

  Fly   136 AAELDHTDNDCLAVAILSHGE----HGYLYAKDTQYKL--DNIWHYFTATFCPSLAGKPKLFFIQ 194
            ||..:|..:|...:.::|||.    .|.::::.|...|  |.|:..|....||.|..|||:..:|
  Rat   188 AALSEHQTSDSTFLVLMSHGTLQGLCGTMHSEATPDVLLYDTIYQIFNNCHCPGLRDKPKVIIVQ 252

  Fly   195 ACQGDRLDGGITLEKGVTETDGESSTSYK---IP------------IHADFLFSYSTIPGYFSWR 244
            ||:     ||...|..:.|:.|  :.||:   :|            :..||:..|||.|.:.|:|
  Rat   253 ACR-----GGNPGEVWIRESSG--AHSYRAVDLPRNMEADAVRMSHVEKDFIALYSTTPHHLSYR 310

  Fly   245 NINNGSWYMQSLIRELNANGKKYDLLTLLTFVNQRVALDFE--SNVPATPMMDRQKQIPCLTSML 307
            :...||:::..||.....:.....|..:...|.|    .||  |.....|.:||        :.|
  Rat   311 DKTRGSYFISKLISCFRIHACSCHLFDIFLKVQQ----SFEKASINSQMPTIDR--------ATL 363

  Fly   308 TR 309
            ||
  Rat   364 TR 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 71/262 (27%)
Casp4NP_446188.2 CARD_CASP1-like 5..85 CDD:260036
CASc 122..371 CDD:214521 71/262 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.