DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment levy and COX13

DIOPT Version :9

Sequence 1:NP_001286770.1 Gene:levy / 37728 FlyBaseID:FBgn0034877 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_011324.1 Gene:COX13 / 852684 SGDID:S000003159 Length:129 Species:Saccharomyces cerevisiae


Alignment Length:116 Identity:35/116 - (30%)
Similarity:58/116 - (50%) Gaps:20/116 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAILNHAIRRQFGAS---AARNMSGTAAVAGEHS-GGYKVWKRLSFFVAVPAVGLCMLNAY---- 58
            |::..:|::..||..   ||:....:.....:|: ....:|.::|.:||:||:.|..:|.|    
Yeast    11 SSLPPNALKPAFGPPDKVAAQKFKESLMATEKHAKDTSNMWVKISVWVALPAIALTAVNTYFVEK 75

  Fly    59 --------LKHQEEHDKPRQEFVKYDYLRRREKRFPWGEGQKSLFHNPHVN 101
                    |||..:.:.||.    |:::..|.|.|.||:|.|:||.||.||
Yeast    76 EHAEHREHLKHVPDSEWPRD----YEFMNIRSKPFFWGDGDKTLFWNPVVN 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
levyNP_001286770.1 Cyt_c_Oxidase_VIa 24..108 CDD:238465 29/91 (32%)
COX13NP_011324.1 COX6A 3..125 CDD:396573 35/116 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I2800
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I1819
Isobase 1 0.950 - 0 Normalized mean entropy S1430
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 1 1.000 - - oto100018
orthoMCL 1 0.900 - - OOG6_102857
Panther 1 1.100 - - LDO PTHR11504
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R240
SonicParanoid 1 1.000 - - X1250
TreeFam 1 0.960 - -
1312.800

Return to query results.
Submit another query.