DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment levy and cox6a2

DIOPT Version :9

Sequence 1:NP_001286770.1 Gene:levy / 37728 FlyBaseID:FBgn0034877 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_001004884.1 Gene:cox6a2 / 448222 XenbaseID:XB-GENE-5784173 Length:105 Species:Xenopus tropicalis


Alignment Length:109 Identity:55/109 - (50%)
Similarity:67/109 - (61%) Gaps:16/109 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAILNHAIRRQFGASAARNMSGTAAVAGEHSGGYKVWKRLSFFVAVPAVGLCMLNAYLKHQEE- 64
            ||:::   .|||. ||.|......||         :.||.|||.||:|.|.:|||||:||.|.. 
 Frog     8 MSSLM---FRRQM-ASEAHEEGAKAA---------RTWKILSFTVALPGVAVCMLNAWLKKQHHP 59

  Fly    65 HDKPRQEFVKYDYLRRREKRFPWGEGQKSLFHNPHVNALPDGYE 108
            |::|:  ||.||:||.|.||||||:|..|.|||||.|.||.|||
 Frog    60 HERPK--FVAYDHLRIRTKRFPWGDGNHSFFHNPHANPLPAGYE 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
levyNP_001286770.1 Cyt_c_Oxidase_VIa 24..108 CDD:238465 45/84 (54%)
cox6a2NP_001004884.1 Cyt_c_Oxidase_VIa 15..101 CDD:238465 50/97 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7348
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I4769
OMA 1 1.010 - - QHG47989
OrthoDB 1 1.010 - - D1591077at2759
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 1 1.000 - - otm49055
Panther 1 1.100 - - LDO PTHR11504
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R240
SonicParanoid 1 1.000 - - X1250
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.