DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment levy and cox6a2

DIOPT Version :9

Sequence 1:NP_001286770.1 Gene:levy / 37728 FlyBaseID:FBgn0034877 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_001004680.1 Gene:cox6a2 / 447942 ZFINID:ZDB-GENE-040912-129 Length:103 Species:Danio rerio


Alignment Length:95 Identity:49/95 - (51%)
Similarity:60/95 - (63%) Gaps:3/95 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ASAARNMSGTAAVAGEHSGGYKVWKRLSFFVAVPAVGLCMLNAYLKHQ-EEHDKPRQEFVKYDYL 78
            |..||.:...|:......||.:.||.|||.:|:|.|.:||.|.|||.| ..|::|  |||.|.:|
Zfish     7 AIVARRVLAAASAGSHEGGGARTWKILSFVLALPGVSVCMANVYLKMQAHSHEQP--EFVPYPHL 69

  Fly    79 RRREKRFPWGEGQKSLFHNPHVNALPDGYE 108
            |.|.|.:|||:|..|||||||.||||.|||
Zfish    70 RIRTKPWPWGDGNHSLFHNPHTNALPTGYE 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
levyNP_001286770.1 Cyt_c_Oxidase_VIa 24..108 CDD:238465 44/84 (52%)
cox6a2NP_001004680.1 Cyt_c_Oxidase_VIa 15..99 CDD:238465 44/85 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7436
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I4796
OMA 1 1.010 - - QHG47989
OrthoDB 1 1.010 - - D1591077at2759
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 1 1.000 - - otm25827
orthoMCL 1 0.900 - - OOG6_102857
Panther 1 1.100 - - O PTHR11504
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R240
SonicParanoid 1 1.000 - - X1250
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.