DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment levy and Cox6a2

DIOPT Version :9

Sequence 1:NP_001286770.1 Gene:levy / 37728 FlyBaseID:FBgn0034877 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_036944.2 Gene:Cox6a2 / 25278 RGDID:2385 Length:97 Species:Rattus norvegicus


Alignment Length:92 Identity:44/92 - (47%)
Similarity:62/92 - (67%) Gaps:6/92 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ARNMSGTAAVAGEHSG-GYKVWKRLSFFVAVPAVGLCMLNAYLKHQEEHDKPRQEFVKYDYLRRR 81
            :|:|:  :|..|:|.| |...|:.|:|.:|:|:|.||.||.:: |...|::|  ||:.|.:||.|
  Rat     9 SRSMA--SASKGDHGGAGANTWRLLTFVLALPSVALCSLNCWM-HAGHHERP--EFIPYHHLRIR 68

  Fly    82 EKRFPWGEGQKSLFHNPHVNALPDGYE 108
            .|.|.||:|..:||||||||.||.|||
  Rat    69 TKPFSWGDGNHTLFHNPHVNPLPTGYE 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
levyNP_001286770.1 Cyt_c_Oxidase_VIa 24..108 CDD:238465 40/84 (48%)
Cox6a2NP_036944.2 Cyt_c_Oxidase_VIa 13..95 CDD:238465 40/86 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352484
Domainoid 1 1.000 87 1.000 Domainoid score I7838
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I4922
OMA 1 1.010 - - QHG47989
OrthoDB 1 1.010 - - D1591077at2759
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 1 1.000 - - otm45971
orthoMCL 1 0.900 - - OOG6_102857
Panther 1 1.100 - - O PTHR11504
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1250
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.