DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment levy and COX6AL

DIOPT Version :9

Sequence 1:NP_001286770.1 Gene:levy / 37728 FlyBaseID:FBgn0034877 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_725504.1 Gene:COX6AL / 246451 FlyBaseID:FBgn0050093 Length:94 Species:Drosophila melanogaster


Alignment Length:72 Identity:41/72 - (56%)
Similarity:54/72 - (75%) Gaps:3/72 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VWKRLSFFVAVPAVGLCMLNAYLKHQEEHDKPRQEFVKYDYLRRREKRFPWGEGQKSLFHNPHVN 101
            :|||::|.:|:||:.||..||:..|:...   |:.|.||:|||||.||||||:|.:|||||..||
  Fly    19 LWKRVTFLLALPAIVLCAANAFTGHKHVE---REPFAKYEYLRRRTKRFPWGDGNRSLFHNAEVN 80

  Fly   102 ALPDGYE 108
            |||:|||
  Fly    81 ALPEGYE 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
levyNP_001286770.1 Cyt_c_Oxidase_VIa 24..108 CDD:238465 39/70 (56%)
COX6ALNP_725504.1 Cyt_c_Oxidase_VIa 14..87 CDD:238465 39/70 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468262
Domainoid 1 1.000 59 1.000 Domainoid score I7065
eggNOG 1 0.900 - - E1_KOG3469
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I4016
Isobase 1 0.950 - 0 Normalized mean entropy S1430
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D135527at33392
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 1 1.000 - - otm14775
orthoMCL 1 0.900 - - OOG6_102857
Panther 1 1.100 - - P PTHR11504
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R240
SonicParanoid 1 1.000 - - X1250
1312.780

Return to query results.
Submit another query.