powered by:
Protein Alignment levy and COX6AL
DIOPT Version :9
Sequence 1: | NP_001286770.1 |
Gene: | levy / 37728 |
FlyBaseID: | FBgn0034877 |
Length: | 109 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_725504.1 |
Gene: | COX6AL / 246451 |
FlyBaseID: | FBgn0050093 |
Length: | 94 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 41/72 - (56%) |
Similarity: | 54/72 - (75%) |
Gaps: | 3/72 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 VWKRLSFFVAVPAVGLCMLNAYLKHQEEHDKPRQEFVKYDYLRRREKRFPWGEGQKSLFHNPHVN 101
:|||::|.:|:||:.||..||:..|:... |:.|.||:|||||.||||||:|.:|||||..||
Fly 19 LWKRVTFLLALPAIVLCAANAFTGHKHVE---REPFAKYEYLRRRTKRFPWGDGNRSLFHNAEVN 80
Fly 102 ALPDGYE 108
|||:|||
Fly 81 ALPEGYE 87
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45468262 |
Domainoid |
1 |
1.000 |
59 |
1.000 |
Domainoid score |
I7065 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3469 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
60 |
1.000 |
Inparanoid score |
I4016 |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S1430 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D135527at33392 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001528 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm14775 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_102857 |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR11504 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R240 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1250 |
|
13 | 12.780 |
|
Return to query results.
Submit another query.