DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment levy and cox-6A

DIOPT Version :9

Sequence 1:NP_001286770.1 Gene:levy / 37728 FlyBaseID:FBgn0034877 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_498082.1 Gene:cox-6A / 175693 WormBaseID:WBGene00006519 Length:128 Species:Caenorhabditis elegans


Alignment Length:74 Identity:27/74 - (36%)
Similarity:41/74 - (55%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KVWKRLSFFVAVPAVGLCMLNAYLKHQEEHDKPRQEFVKYDYLRRREKRFPWGEGQKSLFHNPHV 100
            :.||::.|..::|.:.|.|..|:..|::.....|.|.|:|.:|..|.|.|||.:|..|||||...
 Worm    49 ETWKKIFFIASIPCLALTMYAAFKDHKKHMSHERPEHVEYAFLNVRNKPFPWSDGNHSLFHNKAE 113

  Fly   101 NALPD-GYE 108
            ..:|. |:|
 Worm   114 QFVPGVGFE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
levyNP_001286770.1 Cyt_c_Oxidase_VIa 24..108 CDD:238465 26/72 (36%)
cox-6ANP_498082.1 Cyt_c_Oxidase_VIa 38..122 CDD:238465 26/72 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I7065
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I4016
Isobase 1 0.950 - 0 Normalized mean entropy S1430
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1591077at2759
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 1 1.000 - - otm14775
orthoMCL 1 0.900 - - OOG6_102857
Panther 1 1.100 - - LDO PTHR11504
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R240
SonicParanoid 1 1.000 - - X1250
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.850

Return to query results.
Submit another query.