DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment levy and Cox6a2

DIOPT Version :9

Sequence 1:NP_001286770.1 Gene:levy / 37728 FlyBaseID:FBgn0034877 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_034073.2 Gene:Cox6a2 / 12862 MGIID:104649 Length:97 Species:Mus musculus


Alignment Length:93 Identity:45/93 - (48%)
Similarity:62/93 - (66%) Gaps:6/93 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ARNMSGTAAVAGEHSG-GYKVWKRLSFFVAVPAVGLCMLNAYLKHQEEHDKPRQEFVKYDYLRRR 81
            :|:|:  :|..|:|.| |...|:.|:|.:|:|.|.||.||.:: |...|::|  ||:.|.:||.|
Mouse     9 SRSMA--SAAKGDHGGAGANTWRLLTFVLALPGVALCSLNCWM-HAGHHERP--EFIPYHHLRIR 68

  Fly    82 EKRFPWGEGQKSLFHNPHVNALPDGYEH 109
            .|.|.||:|..:||||||||.||.||||
Mouse    69 TKPFAWGDGNHTLFHNPHVNPLPTGYEH 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
levyNP_001286770.1 Cyt_c_Oxidase_VIa 24..108 CDD:238465 40/84 (48%)
Cox6a2NP_034073.2 Cyt_c_Oxidase_VIa 13..95 CDD:238465 40/86 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848877
Domainoid 1 1.000 85 1.000 Domainoid score I8182
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I5033
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47989
OrthoDB 1 1.010 - - D1591077at2759
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 1 1.000 - - otm43882
orthoMCL 1 0.900 - - OOG6_102857
Panther 1 1.100 - - O PTHR11504
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R240
SonicParanoid 1 1.000 - - X1250
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.