DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment levy and Cox6a1

DIOPT Version :9

Sequence 1:NP_001286770.1 Gene:levy / 37728 FlyBaseID:FBgn0034877 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_031774.2 Gene:Cox6a1 / 12861 MGIID:103099 Length:111 Species:Mus musculus


Alignment Length:114 Identity:54/114 - (47%)
Similarity:72/114 - (63%) Gaps:14/114 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAILNHA-IRRQFGAS---AARNMSGTAAVAGEH--SGGYKVWKRLSFFVAVPAVGLCMLNAYLK 60
            ||:|:.: :.|..|.:   ..|.||     :|.|  .|..::||.|::|||:|.||:.|||.:||
Mouse     3 SAVLSASRVSRPLGRALPGLRRPMS-----SGAHGEEGSARMWKALTYFVALPGVGVSMLNVFLK 62

  Fly    61 -HQEEHDKPRQEFVKYDYLRRREKRFPWGEGQKSLFHNPHVNALPDGYE 108
             ..|||::|  .||.|.:||.|.|.||||:|..:||||||||.||.|||
Mouse    63 SRHEEHERP--PFVAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
levyNP_001286770.1 Cyt_c_Oxidase_VIa 24..108 CDD:238465 44/86 (51%)
Cox6a1NP_031774.2 Cyt_c_Oxidase_VIa 24..109 CDD:238465 47/91 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8182
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3219
Inparanoid 1 1.050 96 1.000 Inparanoid score I5033
Isobase 1 0.950 - 0 Normalized mean entropy S1430
OMA 1 1.010 - - QHG47989
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 1 1.000 - - otm43882
orthoMCL 1 0.900 - - OOG6_102857
Panther 1 1.100 - - LDO PTHR11504
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R240
SonicParanoid 1 1.000 - - X1250
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.810

Return to query results.
Submit another query.