DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG34303

DIOPT Version :10

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001356898.1 Gene:CG34303 / 5740723 FlyBaseID:FBgn0085332 Length:181 Species:Drosophila melanogaster


Alignment Length:127 Identity:31/127 - (24%)
Similarity:59/127 - (46%) Gaps:8/127 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLVVLLGCCFIGQLTNTQLVYKLKKIECLVNRTRVSNVS-CHVKAINWNLAVVNMDCFMIVPLHN 67
            |..:.:.|..|..::.....||...:.|.|....:..:. |.:|||:....::|:..|    |:.
  Fly     6 VAFLCIFCFNIFVISKVHGSYKFNSLACEVMAPELGKMKLCEIKAIDRKHNMINLSAF----LNK 66

  Fly    68 PIIRMQVFTKDYSNQ---YKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPF 126
            .|..:::..|....:   :.||..|::|.:|:..:.|.......:::...|.||||||:||:
  Fly    67 TISEVEIHFKMVKRERGGWHPFFYDIRIDVCQFFKNRRGFFISNLIYSFIKPYTNVNHTCPY 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:461928 16/60 (27%)
CG34303NP_001356898.1 DUF1091 73..157 CDD:461928 16/56 (29%)

Return to query results.
Submit another query.