DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33721

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster


Alignment Length:169 Identity:41/169 - (24%)
Similarity:76/169 - (44%) Gaps:27/169 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLVLVVLLGCCFIGQLTNTQLVYKLKKIECLV-NRTRVSNVSCHVKAINWNLAVVNMDCFMI-VP 64
            ||.::|:    |.|.:.......:....:|.| :.|.:|...|.:|::|.....:::...|. ||
  Fly     7 KLFVLVI----FFGNIMENASKLEFTNFKCHVKDPTYLSFEYCFIKSVNRTYKYISLKANMYEVP 67

  Fly    65 LHNPIIRMQVFTKDYSNQYKPFLVDVKIRICEVIE-RRNFI-PYGVIMWKLFKRYTNVNHSCPFS 127
            :.|...::|:..:..|  |.|..:...|.:|:.:. ::|.. |...:..::.|:|||.||.||:.
  Fly    68 ITNASAKLQISRRFRS--YMPITIAASIDVCKYMAYKKNLANPMLRLFEEITKKYTNTNHKCPYD 130

  Fly   128 GHLIARDGFLD-----------TSLLPPFPQGFYQVSLV 155
            ..||     :|           |::| |.|.|.|..:.:
  Fly   131 HDLI-----IDRLPSKYLSEHFTNIL-PLPPGDYSFNSI 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 25/94 (27%)
CG33721NP_001036743.1 DUF1091 74..160 CDD:284008 25/93 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
33.010

Return to query results.
Submit another query.