DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG12849

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster


Alignment Length:147 Identity:35/147 - (23%)
Similarity:67/147 - (45%) Gaps:21/147 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YKLKKIECLV-NRTRVSNVSCHVKAINWNLAVVNMDCFMI-VPLHNPIIRMQVFTKDYSNQYKPF 86
            ::...:.||| :|..:....|::|::|.....:::...|. :|:.|...|.|:..::  |:...:
  Fly    21 FEFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVDNCETRFQLRMRE--NRRVLY 83

  Fly    87 LVDVKIRICEVIERRNFIPYGVIMW--KLFKRYTNVNHSCPFSGHLIARDGF----LDTSLLPPF 145
            ..|.|:..|:.:..|..:   :..|  :.|..|:|:||:||:. |.|..|..    |:..:....
  Fly    84 NFDFKVDSCKFMRDRKHV---IANWVYQTFGPYSNLNHTCPYD-HDIVLDKLPVQHLNKLVQSII 144

  Fly   146 PQGFYQVSLVVTDTNST 162
            |.|.|.:       |||
  Fly   145 PDGRYMM-------NST 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 22/87 (25%)
CG12849NP_611969.2 DM8 80..172 CDD:214778 22/86 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472610
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.840

Return to query results.
Submit another query.