DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33630

DIOPT Version :10

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster


Alignment Length:116 Identity:30/116 - (25%)
Similarity:49/116 - (42%) Gaps:26/116 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IIRMQVFTK-DYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHLIA 132
            |:.::|..| :.||.:.......:|..||.:...|..|   :|..:||:  ||.           
  Fly    81 IMNIKVRVKPEGSNAFVQLFELRRINFCEFLSEYNTNP---MMEMMFKK--NVK----------- 129

  Fly   133 RDGFLDTSLLPPFPQGFYQVSLVVTD-TNSTSTDYV--GTMKFFLQAMEHI 180
                |:..::.|...|.|  ||:.:| ..:...|.|  ||.:||.:.:|.|
  Fly   130 ----LNDIIVCPVRVGNY--SLLNSDIAENIHADGVQNGTYRFFAEIVEEI 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:461928 18/82 (22%)
CG33630NP_001027166.1 DM8 96..186 CDD:214778 25/101 (25%)

Return to query results.
Submit another query.