DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33679

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster


Alignment Length:162 Identity:40/162 - (24%)
Similarity:80/162 - (49%) Gaps:11/162 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVLVVLLGCCFIGQLTNTQLVYKLKKIEC-LVNRTRVSNVSCHVKAINWNLAVVNMDCFMI-V 63
            ||.:|.:.|  .|||:   :....:|..::| ..:::.|....|.:|.:...:...|:...:: :
  Fly     1 MKYLLWISL--LFIGE---SHGYVRLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKL 60

  Fly    64 PLHNPIIRMQVFTKDYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSG 128
            |::..::|...:.|  .|.|.|||.:|....|.|:...|.:......:..|..::|:||:||::.
  Fly    61 PINRMVVRFITYRK--LNGYHPFLFNVSEEHCRVLRYPNRLRVFYYFYTAFMPFSNINHTCPYND 123

  Fly   129 HLIARDGFLDTSLLP--PFPQGFYQVSLVVTD 158
            .:..|:..||..:..  |.|:|.|:::|.:.|
  Fly   124 DIYIRNCTLDDRMFAKVPLPKGSYKLTLEMDD 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 24/83 (29%)
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 23/80 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
43.940

Return to query results.
Submit another query.