DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33914

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster


Alignment Length:165 Identity:38/165 - (23%)
Similarity:76/165 - (46%) Gaps:35/165 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CLVNRT-------RVSNVSCHVKAINWNL----AV---------VNMDCFMIVPLHNPI-IRMQV 74
            ||:..|       |.:||:|..|.::.::    ||         :::...|:.|:...| |..|:
  Fly    14 CLLFLTELHGVFMRFTNVTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAMLKPMFTNIEIYFQL 78

  Fly    75 FTK-----DYSNQYKPFLVDVKIRICEVIE-RRNFIPYGVIMWKLFKRYTNVNHSCPFSGH-LIA 132
            .|:     ..::.::|||..:|:.:|...: ..|.:  ..::::....:||:||:||::.. .|:
  Fly    79 MTRGSESIHAASNWQPFLHTMKLDLCRFWKNHHNHL--ARMVFEFIDGHTNMNHTCPYTKEKYIS 141

  Fly   133 RDGFLDTSLLP-----PFPQGFYQVSLVVTDTNST 162
            .|...:|.:..     |.|:|||.:....:..|.|
  Fly   142 IDDLTNTEVSAKIRGVPMPKGFYALFTTWSTENIT 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 23/93 (25%)
CG33914NP_001027394.2 DUF1091 85..166 CDD:284008 20/82 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.