DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33764

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster


Alignment Length:176 Identity:42/176 - (23%)
Similarity:78/176 - (44%) Gaps:38/176 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LVYKLKKIECLVNRTRVSNVSCH-------------VKAINWNLAVVNMDCFMI-VPLHNPIIRM 72
            |.|.:.:|..:|   :.:|:.|.             :|::|.:...|::...:: :|:....:|.
  Fly    15 LTYYITEIYSVV---KFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLLKIPVSKVKVRF 76

  Fly    73 QVFTKDYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHLIARDGFL 137
            .::.:  .|.|.|||.::....|..:...|..|..:..:..||.|:|:||||||...:|     |
  Fly    77 GLYKR--VNGYMPFLYNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPFDHDII-----L 134

  Fly   138 D-----------TSLLPPFPQGFYQVSL--VVTDTNSTSTDYVGTM 170
            |           |.:| |||:|.|.:.:  :..|.:...|.:..|:
  Fly   135 DKMPYHSINNKVTKIL-PFPEGKYMIEMHWIAYDIDRAITKFYWTL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 29/92 (32%)
CG33764NP_001027107.1 DUF1091 74..159 CDD:284008 29/92 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472623
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
43.940

Return to query results.
Submit another query.