DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33798

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster


Alignment Length:171 Identity:48/171 - (28%)
Similarity:78/171 - (45%) Gaps:36/171 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VYKLKKIECLVNRTRVS------NVS----CHVKAINWNLAVVNMDCFMIVPLHNPIIRMQVFTK 77
            ::.::|:..||..|...      |.|    |.:|::|.....:::...:   ...|:.:::|.|.
  Fly    11 IFLIRKVHSLVEITNFECESLDRNFSDFEYCRLKSVNRTYKYISLKVHL---FQTPVNQIKVNTA 72

  Fly    78 DYS--NQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHLIARD------ 134
            .|.  |.|||||.:|.:..|:.|:.:|..|....::.:||..||:|||||:...:|...      
  Fly    73 IYKRLNGYKPFLYNVTVDGCKFIKNQNSNPVTKFIFGVFKDATNMNHSCPYDHDIIMEKLSAESI 137

  Fly   135 GFLDTSLLPPFPQGFYQVS--------------LVVTDTNS 161
            .|..|.:| |||:|.|.|.              |.:|.|||
  Fly   138 NFQITKIL-PFPEGKYMVKMNWFAYDINRAIIRLYITLTNS 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 32/89 (36%)
CG33798NP_001027414.1 DUF1091 69..154 CDD:284008 32/85 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472545
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.840

Return to query results.
Submit another query.