DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33920

DIOPT Version :10

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster


Alignment Length:139 Identity:31/139 - (22%)
Similarity:65/139 - (46%) Gaps:15/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CHVKAINWNLAVVNMDCFMIVPLHNPIIRMQ-VFTKDYS--NQYKPFLVDVKIRICEVIERRNFI 104
            |::|::|.:...|::...:   ...||.::. |..|.::  |.|:||:.::.:..|..:......
  Fly    45 CYIKSVNRSYKYVSIKAKL---FKTPITKINGVILKRFNGYNGYRPFMFNITLDACRFMNNTKSN 106

  Fly   105 PYGVIMWKLFKRYTNVNHSCPFSGHLIARD---GFLD---TSLLPPFPQG--FYQVSLVVTDTNS 161
            |....::...:.:||:||:||:...|:...   .|::   |.:| |.|:|  .|:.:.:..|...
  Fly   107 PIASYLYDFIRPFTNMNHNCPYDHDLVIEKLPIHFVNHQVTKVL-PVPEGDYLYETNWMAYDIRR 170

  Fly   162 TSTDYVGTM 170
            ......||:
  Fly   171 AVVKVYGTI 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:461928 22/92 (24%)
CG33920NP_001027214.1 DUF1091 71..158 CDD:461928 21/87 (24%)

Return to query results.
Submit another query.