DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33703

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster


Alignment Length:161 Identity:38/161 - (23%)
Similarity:76/161 - (47%) Gaps:22/161 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVLVVLLGCCFIGQLTNTQLVYKLKKIEC-LVNRTRVSNVSCH-VKAINWNLAVVNMDCFMIV-P 64
            |.|:::|.|       :...|:::.|:|| .::.:.....:|. |:..|...|:...:.|:.. |
  Fly    10 LPLLIILDC-------SQGRVFRVSKMECRSLDPSFTYFKTCKVVRRENGRAALYVSEVFLYKDP 67

  Fly    65 LHNPIIRMQVFTKDYSNQYKPFLVDVKIRICEVIERRNFIP---YGVIMWKLFKRYTNVNHSCPF 126
            :.:.::.:.|| :...|:...||.:. :..|  :..|.::.   :|.:|..|. |.:|:|.:||.
  Fly    68 IDDIVLNLGVF-RIAKNRRFQFLNET-LDYC--LFSRQYLASGFFGFLMTPLL-RISNLNATCPL 127

  Fly   127 SGHLIARDGF-LDTSLLP--PFPQGFYQVSL 154
            ..: |..:|| :|.:.:.  |.|.|.|...|
  Fly   128 QQN-ITFNGFSVDENTIKEIPIPNGVYMFHL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 23/87 (26%)
CG33703NP_001027119.1 DUF1091 73..155 CDD:284008 23/87 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.