DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33137

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:176 Identity:82/176 - (46%)
Similarity:121/176 - (68%) Gaps:2/176 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IGQLTNTQLVYKLKKIECLVNRTRVSNVSCHVKAINWNLAVVNMDCFMIVPLHNPIIRMQVFTKD 78
            |.||:...:|||||.|||.......:|.|||::|||||.||..||.:::.||:|..||.|:..||
  Fly     4 IFQLSEPNIVYKLKNIECSTVPGFSANASCHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKKD 68

  Fly    79 YSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHLIARDGFLDTSLLP 143
            |||:::||||||.|.:|:.:.||:|||||:|:.|:.:.::|.|||||:.|||:||..:|:.|.||
  Fly    69 YSNKFQPFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYLNESYLP 133

  Fly   144 -PFPQGFYQVSLVVTDTNST-STDYVGTMKFFLQAMEHIKSKKTHN 187
             .||.|||:.::.:.:...| .:.:||.:.:::|||..|:.||..|
  Fly   134 NVFPLGFYKFNITIMENYITPPSAHVGGIIWYVQAMHAIQPKKKTN 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 45/82 (55%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 40/90 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471922
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014288
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.840

Return to query results.
Submit another query.