DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG13198

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_610690.1 Gene:CG13198 / 36245 FlyBaseID:FBgn0033640 Length:180 Species:Drosophila melanogaster


Alignment Length:140 Identity:32/140 - (22%)
Similarity:69/140 - (49%) Gaps:10/140 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TQLVYKLKKIECL---VNRTRVSNVSCHVKAINWNLAVVNMDCFMI-VPLHNPIIRMQVFTKDYS 80
            |:|: |...::|:   .:|.......||:|.:..|...:::...:. :|:.|...|:|.|.:  .
  Fly    22 TRLL-KFTNVKCMDLPTSRGLTKYEYCHLKVVRRNQVELSLKVSLFQLPIRNLTTRLQCFQR--R 83

  Fly    81 NQYKPFLVDVKIRICEVIERRNF-IPYGVIMWKLFKRYTNVNHSCPF-SGHLIARDGFLD-TSLL 142
            :.|:||:..:....|:::..||: :.:...::...::.:|.|.:||: ..|:......|| |.:.
  Fly    84 DGYRPFMYYILFDFCKLMASRNYDLSFERFIFDAIRKQSNFNQTCPWKENHMTVEKFALDFTKIS 148

  Fly   143 PPFPQGFYQV 152
            .|.|.|.|::
  Fly   149 MPVPAGTYRL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 21/84 (25%)
CG13198NP_610690.1 DM8 86..179 CDD:214778 18/73 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472584
Domainoid 1 1.000 43 1.000 Domainoid score I19524
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.