DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG12898

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_610581.1 Gene:CG12898 / 36096 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster


Alignment Length:89 Identity:21/89 - (23%)
Similarity:41/89 - (46%) Gaps:21/89 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 FLVDVKIRI---------CEVIERRNFIPYGVIMWKLFKRYTN---VNHS---CPFSG--HLIAR 133
            |.:|:.:::         .|.|:..:|: ...:::|:|....|   ||.|   ||...  :.:..
  Fly    48 FTIDITVKVVKTQRIFYKMENIKGCDFL-NNPLLFKMFGEVYNHLVVNGSYFKCPIKPKVYYLKN 111

  Fly   134 DGFLDTSLLPPF-PQGFYQVSLVV 156
            :|  ..|::|.. |.|.:|:|:.|
  Fly   112 EG--TVSIIPSIHPPGRFQLSMRV 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 18/83 (22%)
CG12898NP_610581.1 DUF1091 48..129 CDD:284008 18/83 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.