DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33454

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:190 Identity:50/190 - (26%)
Similarity:89/190 - (46%) Gaps:34/190 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVLVVLLGCCFIGQLTNTQLVYKLKKIECLVNRTRVSNVS----------CHVKAINWNLAVVNM 57
            |..|::|| .|:.      :|:.:.....:|..|.|...|          |.:||.:.....:::
  Fly     2 LANVIILG-VFVA------VVFLVYSDSAMVKMTNVVCESYDKSLTVFHYCRLKAYSRTKTSLHI 59

  Fly    58 DCFMIVPLHNPIIRMQVFTKDYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNH 122
            :...:.|:::..:|.|:..:  :|.|||||.|:.:..|:.:.:.| .|...|::.:.|..:|:||
  Fly    60 NATFLHPINSISVRFQMLKR--ANGYKPFLFDITVDACQFLRKPN-NPVIKIVYNMIKDASNINH 121

  Fly   123 SCPFSGHLIARDGFLDTSLLPPFPQGFYQVSLVVTDTNSTSTDYV--GTMKFFLQAMEHI 180
            |||: |.::..| |...||..|||.|.|...|          |::  |..||::....|:
  Fly   122 SCPY-GTVVLND-FHRISLPLPFPSGDYLSRL----------DFLINGKTKFYVNVNMHV 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 30/81 (37%)
CG33454NP_995887.1 DUF1091 72..148 CDD:284008 29/80 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471957
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
43.940

Return to query results.
Submit another query.