DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33964 and ORC3

DIOPT Version :9

Sequence 1:NP_001033941.1 Gene:CG33964 / 3772719 FlyBaseID:FBgn0053964 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_197171.2 Gene:ORC3 / 831530 AraportID:AT5G16690 Length:1251 Species:Arabidopsis thaliana


Alignment Length:487 Identity:89/487 - (18%)
Similarity:152/487 - (31%) Gaps:197/487 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RLDGLL--AFLNPHWDFVNCHMV-----NYLTDQHWDGFLSETLKSEIAGKEDVALAIEDLFWKT 69
            |:|.:|  .||.|...|...|.|     :|...|  ||.|:..:::         |.|..|    
plant   306 RMDAVLKAVFLKPCSGFTVSHKVALFMRSYFLCQ--DGTLTSFVRT---------LKIACL---- 355

  Fly    70 DESERFPAWREFLGKSKQERLSLHPKLL-------TSVEELIEGQGNSTQLSIREFMSAKKCHEV 127
                              :..||.|..:       ..|.:|   .|..|:|.....|.    |..
plant   356 ------------------QHFSLEPLSIMLEHFCHDGVNQL---SGEGTELLTEATMK----HAF 395

  Fly   128 DLTAVLVDQLVKNSGQ--DCFIVD-----------------AGDGKGYLSSRLA----------- 162
            ||.:|..:::.:::.:  ..|::|                 ||.   :...||.           
plant   396 DLPSVTRNKITRSTFEMLPHFLLDLQRMPNPWSIVVLCLYEAGK---FDKLRLLDIFCEILDPEA 457

  Fly   163 --LQY--GHRVLGIDANAANTENALNR-NRKLQ-----------RAWNGLT-ERAEL-------- 202
              |:|  ...::...::.:...|.:.| .|||:           ::|..|| |..|:        
plant   458 RYLKYFSPSEIVNSQSHNSGRNNVIRRVLRKLRDLSPSQLSSMLKSWENLTAEFTEINDKVIELH 522

  Fly   203 ----------QVQGI--TPKRRSKKSPARESTKSAPALENYKTTAKFITTE-------LNFGALL 248
                      |.||:  :||:.:.:|.::...:.....:...|..:|:..|       :.|..:|
plant   523 PFMRAVEAAGQRQGLPNSPKKHASRSNSKLEKELKAMTDKVATVIEFMLREYMKPVESVPFHEIL 587

  Fly   249 AENFTQFRPEDSPNICLTG----------------LH--TCGNLAATCLQVFHAQTDCRLLCNVG 295
            .     |:..|.....|.|                ||  .|.....|.|...|   |..:|    
plant   588 C-----FKNVDKLQSALLGDPRGRIQLDLLESHDILHCVCCSQRGTTLLPSMH---DTSIL---- 640

  Fly   296 CCYHLLRERYS-------QQEFFGNKSLMELQTDYGFPLSQYLRERQVRMGRNARMLAAQSIERT 353
              |.|.:|...       .|.|   |:::       .|.|...:::            ::|..::
plant   641 --YKLAQEHADVINLHDWYQSF---KTIL-------IPRSSKAKQK------------SKSSSKS 681

  Fly   354 LDTKEL---PNVTLYYRALLEILVCRHAPELK 382
            ...||:   |....  .||::...||...||:
plant   682 KKRKEICEEPEAPA--EALIQARFCRAVMELQ 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 47/273 (17%)
ORC3NP_197171.2 Orc3 84..732 CDD:412052 89/487 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.