DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33964 and Orc3

DIOPT Version :9

Sequence 1:NP_001033941.1 Gene:CG33964 / 3772719 FlyBaseID:FBgn0053964 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_476904.1 Gene:Orc3 / 36454 FlyBaseID:FBgn0005654 Length:721 Species:Drosophila melanogaster


Alignment Length:229 Identity:46/229 - (20%)
Similarity:74/229 - (32%) Gaps:94/229 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 ICLTGLHTCGNL-------AATCLQVFHAQTDCRLLCNVGCCYHL-----LRERYSQQEFFGNKS 315
            |.:...| ||:|       .||.:...|....          ||:     ||...:|....|...
  Fly   224 ILILSAH-CGSLPFVLVLGVATAMTAVHGTLP----------YHVSSKIRLRVFQTQAAPTGLNE 277

  Fly   316 LME---LQTDYGFPLSQYLRERQVRMGRNARMLAAQSIERTLDTKELPNVTLYY----------- 366
            :::   |...|.|.||          |:..:.|.              ::.|||           
  Fly   278 VLDKVLLSPKYAFHLS----------GKTFKFLT--------------HIFLYYDFSIHGFIQGF 318

  Fly   367 -RALLE-------ILVCR-------HAPELKNELQVGKVRKFESFEEYIQK---C----ATKLDA 409
             ..|:|       ..:|.       ...:|.:| .:..:|:..||..|:::   |    |...|.
  Fly   319 KYCLMEHFFGGNAFALCTDYSKALGRIKQLTHE-DMETIRRLPSFRPYVEQINDCKRIIAVLTDD 382

  Fly   410 PWLAAVEKEELQSLLQEYAVHKYFLDLFYLLRMS 443
            .:|    |::|..||::..:|      |.|.|.|
  Fly   383 DYL----KKKLPQLLRDCLLH------FLLFRCS 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 12/52 (23%)
Orc3NP_476904.1 ORC3_N 26..334 CDD:284456 26/144 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.